Human Cardiolipin Antibodies, IgA, IgG and IgM AssayLite Multiplex Fluorescent Immunoassay Kit |
|||
FAA3CARL | AssayPro | 96 Well Plate | EUR 1472.4 |
Human IgG antibody Laboratories manufactures the igg and igm monoclonal antibodies reagents distributed by Genprice. The Igg And Igm Monoclonal Antibodies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igm monoclonal. Other Igg products are available in stock. Specificity: Igg Category: And Group: Igm Monoclonal
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC941520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF594 conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC941520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF594 conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCAP1520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),Alkaline Phosphatase conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCA1520-250 | Biotium | 250uL | EUR 459.6 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),APC conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-100 | Biotium | 100uL | EUR 250.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNUB1520-500 | Biotium | 500uL | EUR 549.6 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R), Concentration: 0.2mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC041520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC041520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF405S conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC881520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC881520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF488A conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC701520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF770 conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC701520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF770 conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC681520-100 | Biotium | 100uL | EUR 238.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNC681520-500 | Biotium | 500uL | EUR 652.8 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),CF568 conjugate, Concentration: 0.1mg/mL |
Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R) Antibody |
|||
BNCR1520-250 | Biotium | 250uL | EUR 459.6 |
Description: Primary antibody against Negative Control for Rabbit Monoclonal Antibodies (NCRBM/1520R),RPE conjugate, Concentration: 0.1mg/mL |
Monoclonal Serum amyloid Antibodies P-Component (N-term), Clone: EP1018Y |
|||
APR13293G | Leading Biology | 0.1ml | EUR 633.6 |
Description: A Monoclonal antibody against Human Serum amyloid Antibodies P-Component (N-term). The antibodies are raised in Rabbit and are from clone EP1018Y. This antibody is applicable in WB and IHC |